Library holdings

In the present study, lipid membrane interactions of anionic poly(ethyl acrylate-co-methacrylic acid) (MAA) microgels as carriers for the cationic antimicrobial peptide LL-37 ([LL-37, 37 aa]) were investigated. In doing so, neutron reflectometry (NR), Fourier-transform infrared spectroscopy with attenuated total reflection (FTIR-ATR), zeta potential, ellipsometry, and circular dichroism spectroscopy (CD) experiments were employed to investigate the relative importance of membrane interactions of peptide-loaded microgel particles and of released peptide. [...]

Clusters of small heteroaromatic ring molecules pyrrole, imidazole and pyrazole were studied in a molecular beam experiment. Neutral cluster size distributions under various expansion conditions were probed by a scattering experiment with a He-atom beam. [...]

Optogenetics is a fast developing science that combines gene biology and optics to new research fields in neuroscience and cell biology. In the introduction a short literature update of optogenetic tools is given with some emphasis on rhodopsin and flavin based optogenetic tools. [...]

A twin-fluid nozzle was proposed for low-pressure atomization. The nozzle is featured by swirling air flows in the mixing chamber. [...]

The PEC performance of $WO_3/BiVO_4$ heterojunction photoanodes with a fixed $BiVO_4$ thick top layer and different $WO_3$ layer thicknesses was investigated under backside irradiation, in comparison with the performance of the same electrodes without a top $BiVO_4$ layer. While the performance of these latter increase with increasing $WO_3$ thickness, the presence of a $BiVO_4$ layer, besides leading to an effective sensitization up to 520 nm, leads to a decrease of incident photon to current efficiency in the short wavelength's range. [...]