Construction works at FS
Construction works in building 25F required us to remove our holdings from room 257 during that time. To keep all items accessible at all times, these items are shelved at the central library stacks. To access titles marked as HH FS without too much delays, please request them from the holdings tab. They will be prepared for you to pick up at the library desk. (Central library, building 1d) Of course we will also fetch them if you just step by. Please use the central library also if you want to return books.

Library holdings

Latest additions:
2020-10-01
10:58
[PUBDB-2020-03629] Book

Schreib- und Gestaltungsregeln für die Text- und Informationsverarbeitung: unkommentierte Ausgabe der DIN 5008:2020 im Sonderdruckformat
Berlin : Beuth Verlag GmbH : 6. Auflage, VI, 166 Seiten : Illustrationen, Diagramme ()
External link: Download fulltextInhaltsverzeichnis
HH   ORD 1 on order

Detailed record - Similar records
2020-10-01
10:40

Detailed record - Similar records
2020-10-01
10:37
[PUBDB-2020-03624] Book

Gravitational waves: an overview
Morgan & Claypool Publishers 173 pages ()
HH   ORD 1 on order

Detailed record - Similar records
2020-10-01
10:34
[PUBDB-2020-03622] Book

Elektrodynamik und Relativität: das theoretische Minimum: alles, was Sie brauchen, um Physik zu treiben
Berlin : Springer, Das theoretische Minimum 3, xviii, 302 Seiten : Illustrationen ()
HH   ORD 1 on order

Detailed record - Similar records
2020-10-01
10:01
[PUBDB-2020-03617] Book
Radiation protection for particle accelerator facilities: recommendations of the National Council on Radiation Protection and Measurements
Bethesda, Md : National Council on Radiation Protection and Measurements, NCRP report 144, xii, 499 p : ill ()
ZEU   T NCRP 144 1 on loan

Detailed record - Similar records
2020-09-30
16:00
[PUBDB-2020-03613] Journal Article
et al
Membrane interactions of antimicrobial peptide-loaded microgels
In the present study, lipid membrane interactions of anionic poly(ethyl acrylate-co-methacrylic acid) (MAA) microgels as carriers for the cationic antimicrobial peptide LL-37 ([LL-37, 37 aa]) were investigated. In doing so, neutron reflectometry (NR), Fourier-transform infrared spectroscopy with attenuated total reflection (FTIR-ATR), zeta potential, ellipsometry, and circular dichroism spectroscopy (CD) experiments were employed to investigate the relative importance of membrane interactions of peptide-loaded microgel particles and of released peptide. [...]
Fulltext: Download fulltextPDF Download fulltextPDF (PDFA);
ddc:540

Detailed record - Similar records
2020-09-30
15:32
[PUBDB-2020-03612] Journal Article
et al
Mass spectrometry of hydrogen bonded clusters of heterocyclic molecules: Electron ionization vs. photoionization
Clusters of small heteroaromatic ring molecules pyrrole, imidazole and pyrazole were studied in a molecular beam experiment. Neutral cluster size distributions under various expansion conditions were probed by a scattering experiment with a He-atom beam. [...]
Fulltext: Download fulltextPDF Download fulltextPDF (PDFA);
ddc:530

Detailed record - Similar records
2020-09-30
14:49
[PUBDB-2020-03611] Journal Article

Photodynamics of the optogenetic BLUF coupled photoactivated adenylyl cyclases (PACs)
Optogenetics is a fast developing science that combines gene biology and optics to new research fields in neuroscience and cell biology. In the introduction a short literature update of optogenetic tools is given with some emphasis on rhodopsin and flavin based optogenetic tools. [...]
Fulltext: Download fulltextPDF Download fulltextPDF (PDFA);
ddc:660

Detailed record - Similar records
2020-09-30
13:00
[PUBDB-2020-03610] Journal Article
et al
Flow and atomization characteristics of a twin-fluid nozzle with internal swirling and self-priming effects
A twin-fluid nozzle was proposed for low-pressure atomization. The nozzle is featured by swirling air flows in the mixing chamber. [...]
Fulltext: Download fulltextPDF Download fulltextPDF (PDFA);
ddc:600

Detailed record - Similar records
2020-09-30
12:57
[PUBDB-2020-03609] Journal Article

Photoinduced electron transfer in $WO_3 /BiVO_4$ heterojunction photoanodes: effects of the $WO_3$ layer thickness
The PEC performance of $WO_3/BiVO_4$ heterojunction photoanodes with a fixed $BiVO_4$ thick top layer and different $WO_3$ layer thicknesses was investigated under backside irradiation, in comparison with the performance of the same electrodes without a top $BiVO_4$ layer. While the performance of these latter increase with increasing $WO_3$ thickness, the presence of a $BiVO_4$ layer, besides leading to an effective sensitization up to 520 nm, leads to a decrease of incident photon to current efficiency in the short wavelength's range. [...]
Fulltext: Download fulltextPDF Download fulltextPDF (PDFA);
ddc:530

Detailed record - Similar records
Focus on:
Hamburg Library (35,766)
XFEL.EU Library (315)
Zeuthen Library (8,975)